SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000388330 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000388330
Domain Number 1 Region: 201-318
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 4.71e-24
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000227
Further Details:      
 
Domain Number 2 Region: 99-207
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 3.43e-21
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000155
Further Details:      
 
Domain Number 3 Region: 46-97
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000201
Family TS-N domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000388330   Gene: ENSG00000123297   Transcript: ENST00000454289
Sequence length 325
Comment pep:known chromosome:GRCh38:12:57782589:57797584:1 gene:ENSG00000123297 transcript:ENST00000454289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYS
FVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVE
VNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREG
SLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHGAMQSPSLHKLVLGKYGALVIC
ETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYV
QPQGVSVVDFVRFECGEGEEAAETE
Download sequence
Identical sequences E5KS95 P43897
HR6836 hso003016260.1 NP_005717.3.87134 NP_005717.3.92137 ENSP00000388330 ENSP00000388330 gi|171846268|ref|NP_005717.3| 9606.ENSP00000388330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]