SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000388369 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000388369
Domain Number 1 Region: 4-258
Classification Level Classification E-value
Superfamily ALDH-like 3.27e-75
Family ALDH-like 0.00000000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000388369   Gene: ENSG00000108602   Transcript: ENST00000426645
Sequence length 259
Comment pep:novel chromosome:GRCh38:17:19741093:19745133:-1 gene:ENSG00000108602 transcript:ENST00000426645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELNEWNAYYEEVVYVLEE
IEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNLTIQPMVGAIA
AGNSVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKERFDHILYTGST
GVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNSGQTCVAPDYI
LCDPSIQNQIVEKLKKSLK
Download sequence
Identical sequences C9JKT2
ENSP00000388369 ENSP00000388369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]