SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000388474 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000388474
Domain Number 1 Region: 149-406
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.12e-81
Family Eukaryotic proteases 0.000000000629
Further Details:      
 
Domain Number 2 Region: 31-144
Classification Level Classification E-value
Superfamily Kringle-like 7.73e-33
Family Kringle modules 0.0000058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000388474   Gene: ENSG00000122861   Transcript: ENST00000446342
Sequence length 414
Comment pep:known chromosome:GRCh38:10:73911104:73917496:1 gene:ENSG00000122861 transcript:ENST00000446342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFHLRTRYEQANCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHF
YRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQV
GLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIY
RRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVE
NLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITG
FGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSG
GPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
Download sequence
Identical sequences E7ET40
ENSP00000388474 ENSP00000388474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]