SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000388528 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000388528
Domain Number 1 Region: 83-137,190-238
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.49e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 2 Region: 3-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000196
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000388528   Gene: ENSG00000170485   Transcript: ENST00000448812
Sequence length 258
Comment pep:novel chromosome:GRCh38:2:100925146:100971049:1 gene:ENSG00000170485 transcript:ENST00000448812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHNEVSAQTEICD
IQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHLPSDVMDQNLL
NFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPKEFPTYEYIKF
VGNFRSYNNVMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSY
ADVRVERRQELALEDPPS
Download sequence
Identical sequences H7BZA3
ENSP00000388528 ENSP00000388528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]