SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000388858 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000388858
Domain Number 1 Region: 126-225
Classification Level Classification E-value
Superfamily Fibronectin type III 2.14e-18
Family Fibronectin type III 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSP00000388858
Domain Number - Region: 32-87
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00453
Family Fibronectin type III 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000388858   Gene: ENSG00000091181   Transcript: ENST00000418488
Sequence length 325
Comment pep:known chromosome:GRCh38:3:3066326:3110374:-1 gene:ENSG00000091181 transcript:ENST00000418488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA
PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIGNDE
HKPLREWFVIVIMATICFILLILSLICKICHLWIKLFPPIPAPKSNIKDLFVTTNYEKAG
SSETEIEVICYIEKPGVETLEDSVF
Download sequence
Identical sequences E7ERY4
ENSP00000388858 ENSP00000388858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]