SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000389424 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389424
Domain Number 1 Region: 106-165
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-17
Family Kringle modules 0.0000751
Further Details:      
 
Domain Number 2 Region: 19-117
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 8.63e-17
Family Hairpin loop containing domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389424   Gene: ENSG00000122194   Transcript: ENST00000418964
Sequence length 166
Comment pep:putative chromosome:GRCh38:6:160702246:160713026:1 gene:ENSG00000122194 transcript:ENST00000418964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT
CRYFHCRCTYAGICNSDGKAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSEC
KTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEE
Download sequence
Identical sequences A6PVI2
ENSP00000389424 ENSP00000389424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]