SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000389466 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389466
Domain Number 1 Region: 148-465
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-123
Family Transglutaminase core 0.00000000957
Further Details:      
 
Domain Number 2 Region: 5-147
Classification Level Classification E-value
Superfamily E set domains 3.85e-46
Family Transglutaminase N-terminal domain 0.00017
Further Details:      
 
Domain Number 3 Region: 487-606
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.45e-25
Family Transglutaminase, two C-terminal domains 0.0017
Further Details:      
 
Domain Number 4 Region: 608-705
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.44e-24
Family Transglutaminase, two C-terminal domains 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389466   Gene: ENSG00000159495   Transcript: ENST00000452443
Sequence length 710
Comment pep:known chromosome:GRCh38:15:43276280:43302255:-1 gene:ENSG00000159495 transcript:ENST00000452443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQVATLRLESVDLQSSRNNKEHHTQEMGVKRLTVRRGQPFYLRLSFSRPFQSQNDHITF
VAETGPKPSELLGTRATFFLTRVQPGNVWSASDFTIDSNSLQVSLFTPANAVIGHYTLKI
EISQGQGHSVTYPLGTFILLFNPWSPEDDVYLPSEILLQEYIMRDYGFVYKGHERFITSW
PWNYGQFEEDIIDICFEILNKSLYHLKNPAKDCSQRNDVVYVCRVVSAMINSNDDNGVLQ
GNWGEDYSKGVSPLEWKGSVAILQQWSARGGQPVKYGQCWVFASVMCTVMRCLGVPTRVV
SNFRSAHNVDRNLTIDTYYDRNAEMLSTQKRDKIWNFHVWNECWMIRKDLPPGYNGWQVL
DPTPQQTSSGLFCCGPASVKAIREGDVHLAYDTPFVYAEVNADEVIWLLGDGQAQEILAH
NTSSIGKEISTKMVGSDQRQSITSSYKYPEGSPEERAVFMKASRKMLGPQRASLPFLDLL
ESGGLRDQPAQLQLHLARIPEWGQDLQLLLRIQRVPDSTHPRGPIGLVVRFCAQALLHGG
GTQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVEETGRSMLVL
KDICLEPPHLSIEVSERAEVGKALRVHVTLTNTLMVALSSCTMVLEGSGLINGQIAKDLG
TLVAGHTLQIQLDLYPTKAGPRQLQVLISSNEVKEIKGYKDIFVTVAGAP
Download sequence
Identical sequences Q96PF1
ENSP00000389466 gi|16445035|ref|NP_443187.1| ENSP00000389466 9606.ENSP00000389466 ENSP00000389466 NP_443187.1.87134 NP_443187.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]