SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000389535 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389535
Domain Number 1 Region: 2-199
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 1.81e-63
Family Phosphotriesterase-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389535   Gene: ENSG00000165983   Transcript: ENST00000423462
Sequence length 200
Comment pep:known chromosome:GRCh38:10:16436943:16513745:1 gene:ENSG00000165983 transcript:ENST00000423462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEILHGADGTSIKCGIIGEIGCSWPLTESERKVLQATAHAQAQLGCPVIIHPGRSSRAP
FQIIRILQEAGADISKTVMSHLDRTILDKKELLEFAQLGCYLEYDLFGTELLHYQLGPDI
DMPDDNKRIRRVRLLVEEGCEDRILVAHDIHTKTRLMKYGGHGYSHILTNVVPKMLLRGI
TENVLDKILIENPKQWLTFK
Download sequence
Identical sequences A0A0A0MSI3
ENSP00000389535 NP_001248767.1.87134 NP_001248767.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]