SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000389738 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389738
Domain Number 1 Region: 14-165
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 8.63e-24
Family DPP6 N-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389738   Gene: ENSG00000116213   Transcript: ENST00000419924
Sequence length 179
Comment pep:novel chromosome:GRCh38:1:3635272:3650063:-1 gene:ENSG00000116213 transcript:ENST00000419924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFSEVFKLSSLLCKFSPDGKYLASCVQYRLVVRDVNTLQILQLYTCLDQIQHIEWSADS
LFILCAMYKRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWS
LCTKSVSYIKYPKACLQGITFTRDGRYMALAERRDCKDYVSIFVCSDWQLLRYKILLYS
Download sequence
Identical sequences A0A2J8K8Y1 Q5TBW1
ENSP00000389738 ENSP00000389738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]