SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000389854 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389854
Domain Number 1 Region: 115-209
Classification Level Classification E-value
Superfamily Kringle-like 2.16e-36
Family Kringle modules 0.00000574
Further Details:      
 
Domain Number 2 Region: 210-289
Classification Level Classification E-value
Superfamily Kringle-like 3.93e-34
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 3 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 5.3e-24
Family Hairpin loop containing domain 0.00000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389854   Gene: ENSG00000019991   Transcript: ENST00000444829
Sequence length 290
Comment pep:known chromosome:GRCh38:7:81742691:81770031:-1 gene:ENSG00000019991 transcript:ENST00000444829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCET
Download sequence
Identical sequences K7CWX4
NP_001010931.1.87134 NP_001010931.1.92137 XP_003318606.1.37143 XP_016867586.1.92137 gi|58533163|ref|NP_001010931.1| ENSP00000389854 ENSP00000389854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]