SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000389957 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389957
Domain Number 1 Region: 35-230
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.89e-60
Family Inorganic pyrophosphatase 0.00000847
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389957   Gene: ENSG00000138777   Transcript: ENST00000432483
Sequence length 232
Comment pep:putative chromosome:GRCh38:4:105369565:105474050:-1 gene:ENSG00000138777 transcript:ENST00000432483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYI
SPFHDIPLKVNSKEILSCGEVIHVKILGILALIDEGETDWKLIAINANDPEASKFHDIDD
VKKFKPGYLEATLNWFRLYKVPDGKPENQFAFNGEFKNKAFALEVIKSTHQCWKALLMKK
CNGGAINCTNVQISDSPFRCTQEEARSLVESVSSSPNKESNEEEQVWHFLGK
Download sequence
Identical sequences A0A2I3S7L9
ENSP00000389957 NP_789842.2.87134 NP_789842.2.92137 gi|77812680|ref|NP_789842.2| ENSP00000389957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]