SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000390105 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000390105
Domain Number 1 Region: 5-37,66-231
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00000000000000126
Family DPP6 N-terminal domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000390105   Gene: ENSG00000118965   Transcript: ENST00000445063
Sequence length 250
Comment pep:known chromosome:GRCh38:2:19913242:19975636:-1 gene:ENSG00000118965 transcript:ENST00000445063 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XGIQLSHVTWSADSKVLLFGMANGEIHIYDNQGNFMIKMKLSCLVNVTGAISIAGIHWYH
GTEGYVEPDCPCLAVCFDNGRCQIMRHENDQNPVLIDTGMYVVGIQWNHMGSVLAVAGFQ
KAAMQDKDVNIVQFYTPFGEHLGTLKVPGKEISALSWEGGGLKIALAVDSFIYFANIRPN
YKWGYCSNTVVYAYTRPDRPEYCVVFWDTKNNEKYVKYVKGLISITTCGDFCILATKADE
NHPQYHCLLQ
Download sequence
Identical sequences H7BZK8
ENSP00000390105 ENSP00000390105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]