SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000390337 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000390337
Domain Number 1 Region: 34-215
Classification Level Classification E-value
Superfamily DNA-glycosylase 4.55e-48
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000390337   Gene: ENSG00000114026   Transcript: ENST00000441094
Sequence length 222
Comment pep:putative chromosome:GRCh38:3:9750346:9757035:1 gene:ENSG00000114026 transcript:ENST00000441094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPCGPPSRALALSCAWTWFCLLDNLSGVRLLRQDPIECLFSFICSSNNNIARITGMVERL
CQAFGPRLIQLDDVTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGL
AWLQQLRESSYEEAHKALCILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWH
PTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVSVPRCPP
Download sequence
Identical sequences H7BZM3
ENSP00000390337 ENSP00000390337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]