SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000390853 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000390853
Domain Number 1 Region: 39-179
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.51e-37
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000390853   Gene: ENSG00000130762   Transcript: ENST00000418137
Sequence length 180
Comment pep:putative chromosome:GRCh38:1:3471624:3476019:1 gene:ENSG00000130762 transcript:ENST00000418137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFASDLLRALDCCPGAGSSGLLPQLGPRQLLAFTVNCLGNHRYLGFFEDLEQRHKAQVLV
EDISDILEEHAEKHFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPM
LSFLILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERME
Download sequence
Identical sequences B0QZD4
ENSP00000390853 ENSP00000390853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]