SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000391140 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000391140
Domain Number 1 Region: 3-75
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.000000000212
Family Methylmalonyl-CoA epimerase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391140   Gene: ENSG00000124370   Transcript: ENST00000413592
Sequence length 78
Comment pep:novel chromosome:GRCh38:2:71109684:71124451:-1 gene:ENSG00000124370 transcript:ENST00000413592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGRLNHVAIAVPDLEKAAAFYKNILGAQVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPV
IFLHPKDCGGVLVELEQA
Download sequence
Identical sequences A0A2J8KUN3 A0A2J8XBQ3 H7BZS7
ENSP00000391140 ENSP00000391140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]