SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000391145 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000391145
Domain Number 1 Region: 68-266
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-50
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391145   Gene: ENSG00000142632   Transcript: ENST00000449495
Sequence length 307
Comment pep:known chromosome:GRCh38:1:16204811:16206543:-1 gene:ENSG00000142632 transcript:ENST00000449495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRDRGQERLAQFPAAGRGSPGPPGARLGVGLEKGRGREVWRPGVWGCEARASEVNWSCPF
DPVCALPQAKFELITSEASYIHSLSVAVGHFLGSAELSECLGAQDKQWLFSKLPEVKSTS
ERFLQDLEQRLEADVLRFSVCDVVLDHCPAFRRVYLPYVTNQAYQERTYQRLLLENPRFP
GILARLEESPVCQRLPLTSFLILPFQRITRLKMLVENILKRTAQGSEDEDMATKAFNALK
ELVQECNASVQSMKRTEELIHLSKKIHFEGKIFPLISQARWLVRHGELVELAPLPAAPPA
KLKLSSK
Download sequence
Identical sequences H0Y4D8
ENSP00000391145 ENSP00000391145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]