SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000391162 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000391162
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-24
Family PLC-like (P variant) 0.0000674
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391162   Gene: ENSG00000182621   Transcript: ENST00000439627
Sequence length 196
Comment pep:known chromosome:GRCh38:20:8737028:8751236:1 gene:ENSG00000182621 transcript:ENST00000439627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPT
LACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNERNQPLTLPAVFVYIEVKDYVPD
TYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKKEGGFLHDEIMRLTRNTLEKLM
ALPLTHVVPIQSKMLS
Download sequence
Identical sequences Q8IV92
ENSP00000391162 ENSP00000391162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]