SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000391238 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000391238
Domain Number 1 Region: 490-715
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.83e-60
Family Eukaryotic proteases 0.00000000249
Further Details:      
 
Domain Number 2 Region: 205-288
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-34
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 3 Region: 115-204
Classification Level Classification E-value
Superfamily Kringle-like 2.17e-32
Family Kringle modules 0.0000117
Further Details:      
 
Domain Number 4 Region: 297-381
Classification Level Classification E-value
Superfamily Kringle-like 2.13e-31
Family Kringle modules 0.00016
Further Details:      
 
Domain Number 5 Region: 376-472
Classification Level Classification E-value
Superfamily Kringle-like 1.57e-28
Family Kringle modules 0.0004
Further Details:      
 
Domain Number 6 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.35e-23
Family Hairpin loop containing domain 0.00000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391238   Gene: ENSG00000019991   Transcript: ENST00000457544
Sequence length 723
Comment pep:known chromosome:GRCh38:7:81702581:81770048:-1 gene:ENSG00000019991 transcript:ENST00000457544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEG
GPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKF
LPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTEC
IQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWC
FTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRH
IFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVI
SCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYE
AWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCT
IPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIG
SGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKV
PQS
Download sequence
Identical sequences ENSP00000391238 NP_001010932.1.87134 NP_001010932.1.92137 XP_011514417.1.92137 ENSP00000391238 gi|58533170|ref|NP_001010932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]