SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000391512 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000391512
Domain Number 1 Region: 144-226
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.62e-22
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 2 Region: 55-135
Classification Level Classification E-value
Superfamily EF-hand 2.92e-17
Family Polcalcin 0.051
Further Details:      
 
Weak hits

Sequence:  ENSP00000391512
Domain Number - Region: 12-72
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0036
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391512   Gene: ENSG00000127603   Transcript: ENST00000446276
Sequence length 455
Comment pep:novel chromosome:GRCh38:1:39459123:39486987:1 gene:ENSG00000127603 transcript:ENST00000446276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDVWRKKYM
RWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGY
IDYYEFVAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQ
FGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQ
GMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKTSLQFSRCYD
KPWLVNSKAGTPIRDSHSPDLQLPTPEVIPSSGSKLKRPTPTFHSSRTSLAGDTSNSSSP
ASTGAKTNRADPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTSESSAA
GGQGNSRRGLNKPSKIPTMSKKTTTASPRTPGPKR
Download sequence
Identical sequences H0Y4F5
ENSP00000391512 ENSP00000391512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]