SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000391646 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000391646
Domain Number 1 Region: 60-278
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-87
Family Calnexin/calreticulin 0.00000000267
Further Details:      
 
Domain Number 2 Region: 269-409
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 3.4e-58
Family P-domain of calnexin/calreticulin 0.0000000354
Further Details:      
 
Domain Number 3 Region: 412-456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000222
Family Calnexin/calreticulin 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391646   Gene: ENSG00000127022   Transcript: ENST00000452673
Sequence length 592
Comment pep:known chromosome:GRCh38:5:179698906:179730925:1 gene:ENSG00000127022 transcript:ENST00000452673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTY
KAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGL
VLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFH
DKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTL
ILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK
PDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRC
ESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS
AIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEER
PWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDE
EEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
Download sequence
Identical sequences P27824
ENSP00000247461 ENSP00000391646 ENSP00000424063 NP_001019820.1.87134 NP_001019820.1.92137 NP_001737.1.87134 NP_001737.1.92137 XP_011532967.1.92137 ENSP00000247461 ENSP00000391646 ENSP00000424063 9606.ENSP00000247461 Hs10716563___KOG0675 gi|10716563|ref|NP_001737.1| gi|66933005|ref|NP_001019820.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]