SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000392003 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392003
Domain Number 1 Region: 168-272
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.4e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 26-129
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000223
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392003   Gene: ENSG00000159263   Transcript: ENST00000431229
Sequence length 480
Comment pep:putative chromosome:GRCh38:21:36709181:36745871:1 gene:ENSG00000159263 transcript:ENST00000431229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XWGQPSRAGPLDGVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELTGN
SIYEYIHPSDHDEMTAVLTAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGYKV
IHCSGYLKIRQYMLDMSLYDSCYQIVGLVAVGQSLPPSAITEIKLYSNMFMFRASLDLKL
IFLDSRVTEVTGYEPQDLIEKTLYHHVHGCDVFHLRYAHHLLLVKGQVTTKYYRLLSKRG
GWVWVQSYATVVHNSRSSRPHCIVSVNYVLTEIEYKELQLSLEQVSTAKSQDSWRTALST
SQETRKLVKPKNTKMKTKLRTNPYPPQQYSSFQMDKLECGQLGNWRASPPASAAAPPELQ
PHSESSDLLYTPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFLST
LPASGECQWHYANPLVPSSSSPAKNPPEPPANTARHSLVPSYEGKQMSSAEIPPAPQDAD
Download sequence
Identical sequences H7BZX8
ENSP00000392003 ENSP00000392003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]