SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000392045 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392045
Domain Number 1 Region: 298-561
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.7e-87
Family Eukaryotic proteases 0.00000000047
Further Details:      
 
Domain Number 2 Region: 105-210
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-32
Family Kringle modules 0.00016
Further Details:      
 
Domain Number 3 Region: 213-301
Classification Level Classification E-value
Superfamily Kringle-like 1.33e-31
Family Kringle modules 0.00000557
Further Details:      
 
Domain Number 4 Region: 36-85
Classification Level Classification E-value
Superfamily FnI-like domain 2.82e-20
Family Fibronectin type I module 0.0000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392045   Gene: ENSG00000104368   Transcript: ENST00000429089
Sequence length 562
Comment pep:known chromosome:GRCh38:8:42175233:42207565:-1 gene:ENSG00000104368 transcript:ENST00000429089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWN
SMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNYLDWIRDNMRP
Download sequence
Identical sequences P00750
ENSP00000392045 NP_000921.1.87134 NP_000921.1.92137 ENSP00000220809 ENSP00000392045 gi|4505861|ref|NP_000921.1| ENSP00000220809 ENSP00000392045 9606.ENSP00000220809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]