SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000392200 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392200
Domain Number 1 Region: 29-138
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-28
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392200   Gene: ENSG00000234078   Transcript: ENST00000451632
Sequence length 139
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_MANN_CTG1:30929002:30934079:1 gene:ENSG00000234078 transcript:ENST00000451632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR
HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL
RYSRDGRRWMGWKDRWGQE
Download sequence
Identical sequences A0A0G2JHK4
ENSP00000388866 ENSP00000389085 ENSP00000390043 ENSP00000390361 ENSP00000391895 ENSP00000392200 ENSP00000392422 ENSP00000393056 ENSP00000395136 ENSP00000402013 ENSP00000402647 ENSP00000406688 ENSP00000414878 ENSP00000414928 ENSP00000388866 ENSP00000389085 ENSP00000390043 ENSP00000390361 ENSP00000391895 ENSP00000392200 ENSP00000392422 ENSP00000393056 ENSP00000395136 ENSP00000402013 ENSP00000402647 ENSP00000406688 ENSP00000414878 ENSP00000414928 ENSP00000388866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]