SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000392279 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392279
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.62e-33
Family D-ribulose-5-phosphate 3-epimerase 0.0000538
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392279   Gene: ENSG00000197713   Transcript: ENST00000429907
Sequence length 141
Comment pep:putative chromosome:GRCh38:2:210002642:210019940:1 gene:ENSG00000197713 transcript:ENST00000429907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYL
APWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAE
PFGRSLSFTALEVRNFSKIRN
Download sequence
Identical sequences A0A2I3SKJ9 C9IYE8
ENSP00000392279 ENSP00000392279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]