SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000392338 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392338
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.56e-140
Family Carbonic anhydrase 0.0000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392338   Gene: ENSG00000133742   Transcript: ENST00000431316
Sequence length 261
Comment pep:known chromosome:GRCh38:8:85328229:85349901:-1 gene:ENSG00000133742 transcript:ENST00000431316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
Download sequence
Identical sequences P00915 V9HWE3
ENSP00000256119 ENSP00000392338 ENSP00000401551 ENSP00000429798 ENSP00000430656 ENSP00000443517 5gmm_A 5gmm_B 6evr_A 6evr_B 6ex1_A 6ex1_B 6f3b_A 6f3b_B 6faf_A 6faf_B 6fag_A 6fag_B gi|192447430|ref|NP_001122301.1| gi|192447432|ref|NP_001122302.1| gi|192447434|ref|NP_001122303.1| gi|258679498|ref|NP_001158302.1| gi|4502517|ref|NP_001729.1| 9606.ENSP00000256119 ENSP00000256119 NP_001122301.1.87134 NP_001122301.1.92137 NP_001122302.1.87134 NP_001122302.1.92137 NP_001122303.1.87134 NP_001122303.1.92137 NP_001158302.1.87134 NP_001158302.1.92137 NP_001729.1.87134 NP_001729.1.92137 ENSP00000392338 ENSP00000429798 ENSP00000430656 ENSP00000443517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]