SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000392719 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392719
Domain Number 1 Region: 32-76
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-18
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392719   Gene: ENSG00000164048   Transcript: ENST00000427617
Sequence length 96
Comment pep:putative chromosome:GRCh38:3:48241100:48287627:1 gene:ENSG00000164048 transcript:ENST00000427617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAPREQLLGWTAEALPAKDSAWPWEEKPRYLGPVTFEDVAVLFTEAEWKRLSLEQRNLY
KEVMLENLRNLVSLVLELGSPRSGLLPLDLNLDLWL
Download sequence
Identical sequences C9J1J1
ENSP00000392719 ENSP00000392719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]