SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393140 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393140
Domain Number 1 Region: 10-47
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000184
Family G proteins 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393140   Gene: ENSG00000119729   Transcript: ENST00000432183
Sequence length 50
Comment pep:known chromosome:GRCh38:2:46542736:46576656:1 gene:ENSG00000119729 transcript:ENST00000432183 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAGRL
Download sequence
Identical sequences A0A2J8LL80 A0A2J8XDC3 F8WET9
ENSP00000393140 ENSP00000393140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]