SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000393209 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393209
Domain Number 1 Region: 30-213
Classification Level Classification E-value
Superfamily ALDH-like 6.94e-25
Family ALDH-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393209   Gene: ENSG00000159423   Transcript: ENST00000432718
Sequence length 214
Comment pep:novel chromosome:GRCh38:1:18883111:18902724:-1 gene:ENSG00000159423 transcript:ENST00000432718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGR
MEAIPCVVGDEEVWTSDVQYQVSSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLS
GPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTV
YRGLEGFVAAISPFNFTAIGGNLAGAPALMVRCG
Download sequence
Identical sequences Q5TF55
ENSP00000393209 ENSP00000393209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]