SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393423 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393423
Domain Number 1 Region: 29-114
Classification Level Classification E-value
Superfamily C-type lectin-like 9.89e-19
Family Sulfatase-modifying factor-like 0.00000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393423   Gene: ENSG00000129103   Transcript: ENST00000438133
Sequence length 150
Comment pep:known chromosome:GRCh38:7:56064308:56080669:1 gene:ENSG00000129103 transcript:ENST00000438133 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MARHGLPLLPLLSLLVGAWLKLGNGQATSMVQLQGGRFLMGTNSPDSRDGDGPVREATVK
PFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKVKFTHGG
TGSSQTAPTCGRESSPRETKLRMASMESPQ
Download sequence
Identical sequences F8WES7
ENSP00000393423 ENSP00000393423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]