SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393657 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393657
Domain Number 1 Region: 92-215
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.1e-18
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393657   Gene: ENSG00000106772   Transcript: ENST00000424866
Sequence length 260
Comment pep:novel chromosome:GRCh38:9:76614450:76652549:-1 gene:ENSG00000106772 transcript:ENST00000424866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDINVDELDTPDEADSFEYTGHDPTANKDSGQESESIPEYTAEEEREDNRLWRTVVIGEQ
EQRIDMKVIEPYRRVISHGGDSGYYGDGLNAIIVFAACFLPDSSRADYHYVMENLFLYVI
STLELMVAEDYMIVYLNGATPRRRMPGLGWMKKCYQMIDRRLRKNLKSFIIVHPSWFIRT
ILAVTRPFISSKFSSKIKYVNSLSELSGLIPMDCIHIPESIIKYDEERSYKRSVRTSCLY
NDPEMSSMEKDIDLKLKEKP
Download sequence
Identical sequences A0A2J8MRJ6 Q5JUB9
ENSP00000393657 ENSP00000393657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]