SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393849 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393849
Domain Number 1 Region: 126-220
Classification Level Classification E-value
Superfamily PDZ domain-like 2e-21
Family PDZ domain 0.0000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393849   Gene: ENSG00000161202   Transcript: ENST00000423300
Sequence length 220
Comment pep:putative chromosome:GRCh38:3:184156775:184166509:1 gene:ENSG00000161202 transcript:ENST00000423300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERTGGIGDSRPPSFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTA
KGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRR
KQKVSRIERSSSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVLREI
Download sequence
Identical sequences A0A2J8M5C9 A0A2J8WH69 C9K0P9
ENSP00000393849 ENSP00000393849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]