SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000394002 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000394002
Domain Number - Region: 59-137
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00549
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000394002   Gene: ENSG00000143702   Transcript: ENST00000413359
Sequence length 263
Comment pep:novel chromosome:GRCh38:1:243129360:243164494:-1 gene:ENSG00000143702 transcript:ENST00000413359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRLGSLSARSDSEATISRSSASSRTAEAIIRSGARLVPSDKFSPRIRANSISRLSDSKVK
SMTSAHGSASALKTTRLQSAGSAMPTSSSFKHRIKEQEDYIRDWTAHREEIARISQDLAL
IAREINDVAGEIDSVTSSGTAPSTTLVDRVFDESLNFRKIPPLVHSKTPEGNNGRSGDPR
PQAAEPPDHLTITRRRTWSRDEVMGDNLLLSSVFQFSKKIRQSIDKTAGKIRILFKDKDR
NWDDIESKLRAESEVPIVKTSSM
Download sequence
Identical sequences A0A2J8KNG0 H0Y4T4
ENSP00000394002 ENSP00000394002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]