SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000394063 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000394063
Domain Number 1 Region: 124-336,363-423,457-491
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000167
Family Quinoprotein alcohol dehydrogenase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000394063   Gene: ENSG00000084444   Transcript: ENST00000416494
Sequence length 622
Comment pep:known chromosome:GRCh38:12:13044381:13083449:1 gene:ENSG00000084444 transcript:ENST00000416494 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MATVLSRALKLPGKKSPDLGEYDPLTQADSDESEDDLVLNLQKNGGVKNGKSPLGEAPEP
DSDAEVAEAAKPHLSEVTTEGYPSEPLGGLEQKAASSLVSYVRTSVFLLTLGISMILVLL
CAFLIPCPPRDLHSTWSRHLGSQGGGDLSPLELADVNGDGLRDVLLSFVMSRNGSAVGVS
RPAANLVCLSGMNGSTLWSSLLPEEARDITCLELMPGSLAETICLVTGTHKMLSAFNATS
GKAIWTLNPNYLSNGTLAAPVVVLPDLDEDGVRDLVVLAIGELQPDLCFLLVSGRTGNPV
GRPVKYNIVGVGNLIGPQVYITTNGAVYILFGFGNIQAVALRDIFVQAQNRDSSPPSLQI
EEPEWEKRRSINLSELIDVYSDGVELLQMVKAPDSNCSNLLITTRQSLVLLRGQNLTPYW
ALRLQGLRSQPTPGYFTDDQTLDFLLQIQDGVGMKKMMVVDGDSGSIVWSYRAPCHMKET
PATSAVTSDQKSVFLFWAEGLSAASPNSDIILGTEPPSLHHLYLLHPAFPSILLDLANTT
GTVTASEVGINDLWKDAFYVTRTTGPSSEGHPAALVVSKLSLRWALMEGQMAQLQESTPK
IGRGELRRFLSRIKFVEAPYEI
Download sequence
Identical sequences A2RU67
ENSP00000197268 ENSP00000394063 ENSP00000197268 ENSP00000394063 gi|62821776|ref|NP_065904.1| ENSP00000197268 NP_065904.1.87134 NP_065904.1.92137 9606.ENSP00000197268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]