SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000394066 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000394066
Domain Number 1 Region: 44-86
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000177
Family FKBP immunophilin/proline isomerase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000394066   Gene: ENSG00000102309   Transcript: ENST00000439980
Sequence length 91
Comment pep:known chromosome:GRCh38:X:72181765:72302926:1 gene:ENSG00000102309 transcript:ENST00000439980 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
VQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIME
AMEKLKSGMRFNEVAAQYSEDKARQGAFRLR
Download sequence
Identical sequences A0A2J8IVY3 H0Y4T6
ENSP00000394066 ENSP00000394066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]