SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000394237 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000394237
Domain Number 1 Region: 412-610
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.81e-69
Family Hemopexin-like domain 0.00000000174
Further Details:      
 
Domain Number 2 Region: 38-168,341-396
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.99e-38
Family Matrix metalloproteases, catalytic domain 0.000000305
Further Details:      
 
Domain Number 3 Region: 287-343
Classification Level Classification E-value
Superfamily Kringle-like 1.83e-21
Family Fibronectin type II module 0.0000635
Further Details:      
 
Domain Number 4 Region: 227-284
Classification Level Classification E-value
Superfamily Kringle-like 3.71e-21
Family Fibronectin type II module 0.0000526
Further Details:      
 
Domain Number 5 Region: 171-226
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-20
Family Fibronectin type II module 0.0000528
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000394237   Gene: ENSG00000087245   Transcript: ENST00000437642
Sequence length 610
Comment pep:known chromosome:GRCh38:16:55481557:55505759:1 gene:ENSG00000087245 transcript:ENST00000437642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANY
NFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIM
INFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADG
EYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQP
CKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCV
FPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMG
LEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICK
QDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEE
KAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWR
YNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKF
GSIKSDWLGC
Download sequence
Identical sequences A0A2I2ZH84
gi|189217853|ref|NP_001121363.1| ENSP00000394237 ENSP00000394237 NP_001121363.1.87134 NP_001121363.1.92137 XP_004057706.2.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]