SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000394464 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000394464
Domain Number - Region: 98-163
Classification Level Classification E-value
Superfamily ARM repeat 0.000104
Family Regulatory subunit H of the V-type ATPase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000394464   Gene: ENSG00000132792   Transcript: ENST00000447935
Sequence length 166
Comment pep:known chromosome:GRCh38:20:37694032:37765212:1 gene:ENSG00000132792 transcript:ENST00000447935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRKQTGTRERGRYREEEMTVVEEADDDKKRLLQIIDRDGEEEEEEEEPLDESSVKKMIL
TFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELNAVQSLL
GLLGHDNTDVSIAVVDLLQELTDIDTLHESEEGAEVLIDALVDGQV
Download sequence
Identical sequences A2A2P1
ENSP00000394464 ENSP00000394464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]