SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000394487 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000394487
Domain Number 1 Region: 198-410
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.68e-59
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 393-555
Classification Level Classification E-value
Superfamily PH domain-like 2e-34
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 
Domain Number 3 Region: 577-738
Classification Level Classification E-value
Superfamily PH domain-like 6.88e-23
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000394487   Gene: ENSG00000139132   Transcript: ENST00000427716
Sequence length 766
Comment pep:known chromosome:GRCh38:12:32502160:32646050:1 gene:ENSG00000139132 transcript:ENST00000427716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEIKPASASCVSKEKPSKVSDLISRFEGGSSLSNYSDLKKESAVNLNAPRTPGRHGLTT
TPQQKLLSQHLPQRQGNDTDKTQGAQTCVANGVMAAQNQMECEEEKAATLSSDTSIQASE
PLLDTHIVNGERDETATAPASPTTDSCDGNASDSSYRTPGIGPVLPLEERGAETETKVQE
RENGESPLELEQLDQHHEMKETNEQKLHKIANELLLTERAYVNRLDLLDQVFYCKLLEEA
NRGSFPAEMVNKIFSNISSINAFHSKFLLPELEKRMQEWETTPRIGDILQKLAPFLKMYG
EYVKGFDNAMELVKNMTERIPQFKSVVEEIQKQKICGSLTLQHHMLEPVQRIPRYEMLLK
DYLRKLPPDSLDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPS
NELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPKFSLVGSKFTVRTRVGIDGMKIVE
TQNEEYPHTFQVSGKERTLELQASSAQDKEEWIKALQETIDAFHQRHETFRNAIAKDNDI
HSEVSTAELGKRAPRWIRDNEVTMCMKCKEPFNALTRRRHHCRACGYVVCWKCSDYKAQL
EYDGGKLSKVCKDCYQIISGFTDSEEKKRKGILEIESAEVSGNSVVCSFLQYMEKSKPWQ
KAWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDEMPRSADLPHSFKLTQSKSVHSF
AADSEELKQKWLKVILLAVTGETPGGPNEHPATLDDHPEPKKKSEC
Download sequence
Identical sequences Q96M96
ENSP00000394487 ENSP00000394487 9606.ENSP00000394487 gi|198041928|ref|NP_640334.2| NP_640334.2.87134 NP_640334.2.92137 XP_011518857.1.92137 XP_011518858.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]