SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000394827 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000394827
Domain Number 1 Region: 118-251
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-25
Family DBL homology domain (DH-domain) 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSP00000394827
Domain Number - Region: 23-55,106-133
Classification Level Classification E-value
Superfamily EF-hand 0.0881
Family Calbindin D9K 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000394827   Gene: ENSG00000154783   Transcript: ENST00000457774
Sequence length 252
Comment pep:putative chromosome:GRCh38:3:14821432:14900453:1 gene:ENSG00000154783 transcript:ENST00000457774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XQIPPRRPARAGAFTKLFEDQSRALSTANENDGYVDMSSFNAFESKQQSADQDAESAYTE
PYKVCPISSAAPKEDLTSDEEQRSSEEEDSASRDPSVTHKDFHGAVMRALDDMDHEGRDT
LAREELRQGLSELPAIHDLHQGILEELEERLSNWESQQKVADVFLAREQGFDHHATHILQ
FDRYLGLLSENCLHSPRLAAAVREFEQSVQGGSQTAKHRLLRVVQRLFQYQVLLTDYLNN
LCPDSAEYDNTQ
Download sequence
Identical sequences H7C0G2
ENSP00000394827 ENSP00000394827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]