SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000395186 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000395186
Domain Number 1 Region: 4-49
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000494
Family BTB/POZ domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395186   Gene: ENSG00000173276   Transcript: ENST00000449949
Sequence length 49
Comment pep:known chromosome:GRCh38:21:41993948:42010357:-1 gene:ENSG00000173276 transcript:ENST00000449949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLLHYINPAHAISLLSALNEERLKGQLCDVLLIVGDQKFRAHKNVLA
Download sequence
Identical sequences A0A2J8M873 A0A2J8UAX5 Q5KS07
ENSP00000381510 ENSP00000395186 ENSP00000381510 ENSP00000395186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]