SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000395468 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000395468
Domain Number 1 Region: 11-58
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000169
Family Kringle modules 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395468   Gene: ENSG00000019991   Transcript: ENST00000453018
Sequence length 58
Comment pep:putative chromosome:GRCh38:7:81756986:81762996:-1 gene:ENSG00000019991 transcript:ENST00000453018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHR
Download sequence
Identical sequences A0A2J8LGB7 A0A2J8VLJ3 C9JJ35
ENSP00000395468 ENSP00000395468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]