SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000395743 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000395743
Domain Number 1 Region: 67-148
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 5.1e-21
Family Band 7/SPFH domain 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSP00000395743
Domain Number - Region: 163-277
Classification Level Classification E-value
Superfamily ALDH-like 0.0229
Family ALDH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395743   Gene: ENSG00000165283   Transcript: ENST00000452248
Sequence length 311
Comment pep:known chromosome:GRCh38:9:35099776:35103195:-1 gene:ENSG00000165283 transcript:ENST00000452248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARAARGTGALLLRGSLLASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEYAVTQLAQTTMRSELGKLSLDKVFRVEAERRKRATVLESEGTRESAINVAEGKKQAQ
ILASEAEKAEQINQAAGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSA
FSKLAKDSNTILLPSNPGDVTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDAS
LDEELDRVKMS
Download sequence
Identical sequences A0A2I2ZWL8 A0A2I3RFT8 A0A2J8T0H4
ENSP00000395743 ENSP00000395743 NP_001273960.1.87134 NP_001273960.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]