SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000395749 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000395749
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000392
Family DBL homology domain (DH-domain) 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSP00000395749
Domain Number - Region: 182-251
Classification Level Classification E-value
Superfamily PH domain-like 0.0134
Family Pleckstrin-homology domain (PH domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395749   Gene: ENSG00000178038   Transcript: ENST00000423707
Sequence length 302
Comment pep:known chromosome:GRCh38:3:46670600:46688191:-1 gene:ENSG00000178038 transcript:ENST00000423707 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XLQERLRYPDSTGLESLLLLRGADRVLQAHIEYIESYTSCMVVQAFQKAAKRRSEYWRGQ
RKALRQLLSGVSSEGSVGASLGQALHQPLAHHVQQYVLLLLSLGDTIGEHHPTRELVVNA
VTLFGNLQSFMKQELDQAVATQALWHTLRGRLRDVLCTPAHRLLQDSQDVPVTVAPLRAE
RVLLFDDALVLLQGHNVHTFDLKLVWVDPGQDGCTFHLLTPEEEFSFCAKDSQGQAVWQW
KVTWAVHQALHGKKDFPVLGAGLEPSQPPDCRCAEYTFQAEGRLCQATYEGEWCRGRPHG
EP
Download sequence
Identical sequences H7C0M4
ENSP00000395749 ENSP00000395749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]