SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000395881 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000395881
Domain Number 1 Region: 314-800
Classification Level Classification E-value
Superfamily ALDH-like 1.2e-165
Family ALDH-like 0.000000000726
Further Details:      
 
Domain Number 2 Region: 1-132
Classification Level Classification E-value
Superfamily Formyltransferase 8.37e-27
Family Formyltransferase 0.000000306
Further Details:      
 
Domain Number 3 Region: 113-205
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.04e-18
Family Post formyltransferase domain 0.00000242
Further Details:      
 
Domain Number 4 Region: 224-307
Classification Level Classification E-value
Superfamily ACP-like 0.00000489
Family Acyl-carrier protein (ACP) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395881   Gene: ENSG00000144908   Transcript: ENST00000452905
Sequence length 801
Comment pep:novel chromosome:GRCh38:3:126103573:126180586:-1 gene:ENSG00000144908 transcript:ENST00000452905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKYSRWR
AKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLLPRHRGASAIH
NWIRGNDKVPGAWTEACEQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFG
NDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEV
EDSTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEE
GECSIDYVEMAVNKRTVRMPHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDV
DKAVAAAKDAFENGRWGKISARDRGRLMYRLADLMEQHQEELATIEALDAGAVYTLALKT
HVGMSIQTFRYFAGWCDKIQGSTIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLS
WKTAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNVLPGSGSLVGQRLSDHP
DVRKIGFTGSTEVGKHIMKSCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFF
NKGENCIAAGRLFVEDSIHDEFVRRVVEEVRKMKVGNPLDRDTDHGPQNHHAHLVKLMEY
CQHGVKEGATLVCGGNQVPRPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDLD
AVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFG
KDLGEAALNEYLRVKTVTFEY
Download sequence
Identical sequences ENSP00000395881 ENSP00000395881 NP_001257294.1.87134 NP_001257294.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]