SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000395913 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000395913
Domain Number 1 Region: 26-63
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000000000378
Family Tyrosine-dependent oxidoreductases 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395913   Gene: ENSG00000242612   Transcript: ENST00000445291
Sequence length 81
Comment pep:known chromosome:GRCh38:16:401926:411471:1 gene:ENSG00000242612 transcript:ENST00000445291 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASR
SLPRVLTRWVFTTLTRLVSNS
Download sequence
Identical sequences G3V0I9
ENSP00000395913 ENSP00000402180 ENSP00000395913 ENSP00000402180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]