SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000396247 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396247
Domain Number 1 Region: 32-159
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 2.62e-27
Family Band 7/SPFH domain 0.0000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396247   Gene: ENSG00000236271   Transcript: ENST00000411848
Sequence length 192
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_MANN_CTG1:30784913:30786861:-1 gene:ENSG00000236271 transcript:ENST00000411848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVKIQGQ
NKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVAS
SDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQ
EKVSAQYLSEIE
Download sequence
Identical sequences A0A2J8NXA9 A0A2J8SJE7 A2AB11
ENSP00000389138 ENSP00000391633 ENSP00000392683 ENSP00000396247 ENSP00000407122 ENSP00000412058 ENSP00000389138 ENSP00000391633 ENSP00000392683 ENSP00000396247 ENSP00000407122 ENSP00000412058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]