SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000396509 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000396509
Domain Number - Region: 52-149
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 0.0144
Family DNA repair protein MutS, domain II 0.024
Further Details:      
 
Domain Number - Region: 223-270
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0288
Family DNA repair protein MutS, domain III 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396509   Gene: ENSG00000230961   Transcript: ENST00000436091
Sequence length 270
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_MANN_CTG1:31779451:31786880:1 gene:ENSG00000230961 transcript:ENST00000436091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLGANPRRTPQGPRPGAASSGFPSPAPVPGPREAEEEEVEEEEELAEIHLCVLWNSGY
LGIAYYDTSDSTIHFMPDAPDHESLKLLQRVLDEINPQSVVTSAKQDENMTRFLGKLASQ
EHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTV
RALGGLLKFLGRRRIGVELEDYNVSVPILGFKKFMLTHLVNIDQDTYSVLQIFKSESHPS
VYKVASGLKEGLSLFGILNRCHCKWGEKLL
Download sequence
Identical sequences ENSP00000396509 ENSP00000400187 ENSP00000404892 ENSP00000396509 ENSP00000400187 ENSP00000404892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]