SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000396531 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396531
Domain Number 1 Region: 11-176
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-35
Family DBL homology domain (DH-domain) 0.0012
Further Details:      
 
Domain Number 2 Region: 189-249
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000234
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396531   Gene: ENSG00000186716   Transcript: ENST00000427791
Sequence length 257
Comment pep:putative chromosome:GRCh38:22:23253960:23285114:1 gene:ENSG00000186716 transcript:ENST00000427791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLNLRARSNKDAKDPTTK
NSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRR
QSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWY
IPLTDLSFQMVDELEAV
Download sequence
Identical sequences A0A2J8IY26 H0Y554
ENSP00000396531 ENSP00000396531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]