SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000396702 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396702
Domain Number 1 Region: 5-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000314
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396702   Gene: ENSG00000242441   Transcript: ENST00000437125
Sequence length 335
Comment pep:novel chromosome:GRCh38:2:48617798:48647042:1 gene:ENSG00000242441 transcript:ENST00000437125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACLNPVPKLYRSVIEDVIEGVRNLFAEEGIEEQVLKDLKQLWETKVLQSKATEDFFRNS
IQSPLFTLQLPHSLHQTLQSSTGWIPLVNEYSSLVIPAGRTLPSFTTAELGTSNSSANFT
FPGYPIHVPAGVTLQTVSGHLYKVNVPIMVTETSGRAGILQHPIQQVFQQLGQPSVIQTS
VPQLNPWSLQATTEKSQRIETVLQQPAILPSGPVDRKHLENATSDILVSPGNEHKIVPEA
LLCHQESSHYISLPGVVFSPQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQHV
TDIQLHILKNRMYGCDSVKQPRNIEEPSNIPVSEK
Download sequence
Identical sequences C9JJY0
ENSP00000396702 ENSP00000396702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]