SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000397026 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000397026
Domain Number 1 Region: 34-410
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.78e-69
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Domain Number 2 Region: 430-545,664-804
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.1e-68
Family Phosphate binding protein-like 0.000000000681
Further Details:      
 
Weak hits

Sequence:  ENSP00000397026
Domain Number - Region: 516-659
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0022
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000397026   Gene: ENSG00000164418   Transcript: ENST00000421544
Sequence length 908
Comment pep:known chromosome:GRCh38:6:101398788:102070083:1 gene:ENSG00000164418 transcript:ENST00000421544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIIFPILSNPVFRRTVKLLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS
ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST
GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK
QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFM
SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI
RLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKS
NEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVG
EFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRR
LPGKETMA
Download sequence
Identical sequences A0A2I2Z6L3 A0A2I3GH36 A0A2J8SK60 A0A2K5BUS4 A0A2K5JHI5 A0A2K5LJ69 A0A2K5X6H7 A0A2K6BKA4 C7G3L5 H9EM65 Q13002
gi|11386137|ref|NP_068775.1| 9598.ENSPTRP00000031512 9606.ENSP00000397026 NP_001158172.1.37143 NP_068775.1.87134 NP_068775.1.92137 XP_002746910.1.60252 XP_003258425.1.23891 XP_003824398.1.60992 XP_005267002.1.92137 XP_005552325.1.63531 XP_008005676.1.81039 XP_008976330.1.60992 XP_008993074.1.60252 XP_009449944.1.37143 XP_009449945.1.37143 XP_011734731.1.29376 XP_011791897.1.43180 XP_011922272.1.92194 XP_012293830.1.9421 XP_014200916.1.60992 XP_014992481.1.72884 XP_014992483.1.72884 XP_015304519.1.63531 XP_015304520.1.63531 XP_018885625.1.27298 ENSP00000397026 ENSP00000397026 ENSP00000313276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]