SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000397395 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000397395
Domain Number 1 Region: 61-136
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000189
Family RhoGDI-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000397395   Gene: ENSG00000242173   Transcript: ENST00000435035
Sequence length 136
Comment pep:putative chromosome:GRCh38:16:268727:282084:1 gene:ENSG00000242173 transcript:ENST00000435035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASCDGCVGSRPPVHLASGYSLADLLVLEMGMGTQCWTEDQRRWSSLWPWSHLSSVLLA
DKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSL
PNVQVTRLTLLSEQAP
Download sequence
Identical sequences C9J9L9
ENSP00000397395 ENSP00000397395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]